Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein Clp protease, ClpP subunit [52098] (9 species) |
Species Listeria monocytogenes [TaxId:1639] [311108] (1 PDB entry) |
Domain d4ryfe_: 4ryf E: [268832] automated match to d4jcta_ complexed with mli, na |
PDB Entry: 4ryf (more details), 2.8 Å
SCOPe Domain Sequences for d4ryfe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ryfe_ c.14.1.1 (E:) Clp protease, ClpP subunit {Listeria monocytogenes [TaxId: 1639]} itniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdt ihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvqgqstei eieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrd
Timeline for d4ryfe_: