| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
| Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
| Protein Clp protease, ClpP subunit [52098] (11 species) |
| Species Listeria monocytogenes [TaxId:1639] [311108] (1 PDB entry) |
| Domain d4ryfd_: 4ryf D: [268830] automated match to d4jcta_ complexed with mli, na |
PDB Entry: 4ryf (more details), 2.8 Å
SCOPe Domain Sequences for d4ryfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ryfd_ c.14.1.1 (D:) Clp protease, ClpP subunit {Listeria monocytogenes [TaxId: 1639]}
itniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdt
ihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvqgqstei
eieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdg
Timeline for d4ryfd_: