Lineage for d4ryfd_ (4ryf D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852296Protein Clp protease, ClpP subunit [52098] (11 species)
  7. 2852427Species Listeria monocytogenes [TaxId:1639] [311108] (1 PDB entry)
  8. 2852431Domain d4ryfd_: 4ryf D: [268830]
    automated match to d4jcta_
    complexed with mli, na

Details for d4ryfd_

PDB Entry: 4ryf (more details), 2.8 Å

PDB Description: clpp1/2 heterocomplex from listeria monocytogenes
PDB Compounds: (D:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4ryfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ryfd_ c.14.1.1 (D:) Clp protease, ClpP subunit {Listeria monocytogenes [TaxId: 1639]}
itniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdt
ihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvqgqstei
eieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdg

SCOPe Domain Coordinates for d4ryfd_:

Click to download the PDB-style file with coordinates for d4ryfd_.
(The format of our PDB-style files is described here.)

Timeline for d4ryfd_: