Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (60 species) not a true protein |
Species Neisseria meningitidis [TaxId:272831] [268818] (1 PDB entry) |
Domain d4ryba1: 4ryb A:2-176 [268819] automated match to d4nhdd1 complexed with gol |
PDB Entry: 4ryb (more details), 2.45 Å
SCOPe Domain Sequences for d4ryba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ryba1 c.95.1.0 (A:2-176) automated matches {Neisseria meningitidis [TaxId: 272831]} qyakisgtgsylpanrvsnddlaqkvdtsdewitartgikfrhiaaenektsdlaaeaar raldaagldsgeidliivatatpdmqfpstativqqklgitngcpafdvqavcagfmyal ttanayiksgmaknalvigaetfsrivdwndrttcvlfgdgagavvlsaadkpgi
Timeline for d4ryba1: