SCOPe 2.06: Domain d4ryba1: 4ryb A:2-176

Lineage for d4ryba1 (4ryb A:2-176)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:272831] [268818] (1 PDB entry)

8. Domain d4ryba1: 4ryb A:2-176 [268819]
   automated match to d4nhdd1
   complexed with gol

Details for d4ryba1

PDB Entry: 4ryb, 2.45 Å

PDB Description: Crystal structure of beta-ketoacyl-ACP synthase III (FabH) from Neisseria meningitidis

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d4ryba1:

Sequence; same for both SEQRES and ATOM records:

>d4ryba1 c.95.1.0 (A:2-176) automated matches {Neisseria meningitidis [TaxId: 272831]}
qyakisgtgsylpanrvsnddlaqkvdtsdewitartgikfrhiaaenektsdlaaeaar
raldaagldsgeidliivatatpdmqfpstativqqklgitngcpafdvqavcagfmyal
ttanayiksgmaknalvigaetfsrivdwndrttcvlfgdgagavvlsaadkpgi

Timeline for d4ryba1:

• d4ryba1 first appeared in SCOPe 2.05
  
• d4ryba1 appears in SCOPe 2.07
  
• d4ryba1 appears in the current release, SCOPe 2.08