Lineage for d4ryba1 (4ryb A:2-176)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918059Species Neisseria meningitidis [TaxId:272831] [268818] (1 PDB entry)
  8. 2918060Domain d4ryba1: 4ryb A:2-176 [268819]
    automated match to d4nhdd1
    complexed with gol

Details for d4ryba1

PDB Entry: 4ryb (more details), 2.45 Å

PDB Description: Crystal structure of beta-ketoacyl-ACP synthase III (FabH) from Neisseria meningitidis
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d4ryba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ryba1 c.95.1.0 (A:2-176) automated matches {Neisseria meningitidis [TaxId: 272831]}
qyakisgtgsylpanrvsnddlaqkvdtsdewitartgikfrhiaaenektsdlaaeaar
raldaagldsgeidliivatatpdmqfpstativqqklgitngcpafdvqavcagfmyal
ttanayiksgmaknalvigaetfsrivdwndrttcvlfgdgagavvlsaadkpgi

SCOPe Domain Coordinates for d4ryba1:

Click to download the PDB-style file with coordinates for d4ryba1.
(The format of our PDB-style files is described here.)

Timeline for d4ryba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ryba2