SCOPe 2.07: Domain d4ry1b1: 4ry1 B:31-439

Lineage for d4ry1b1 (4ry1 B:31-439)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Pectobacterium atrosepticum [TaxId:218491] [268814] (1 PDB entry)

8. Domain d4ry1b1: 4ry1 B:31-439 [268816]
   Other proteins in same PDB: d4ry1a2, d4ry1b2
   automated match to d2uvga_
   complexed with act, gol

Details for d4ry1b1

PDB Entry: 4ry1, 1.4 Å

PDB Description: crystal structure of periplasmic solute binding protein eca2210 from pectobacterium atrosepticum scri1043, target efi-510858

PDB Compounds: (B:) Periplasmic solute binding protein

SCOPe Domain Sequences for d4ry1b1:

Sequence; same for both SEQRES and ATOM records:

>d4ry1b1 c.94.1.0 (B:31-439) automated matches {Pectobacterium atrosepticum [TaxId: 218491]}
aeiriswwggnqrheatlaainafqkanptitvkaeyagwdgylsrlstqiaggqepdvm
ridwnwlpqfsrngdgfydlnkqkdilglgdfppnalktadvkgklqglpismtsrsmiy
nkttwdnagvaypktwdelfaagpvfkqklgdsyyplgvaqgasdvldiltlgrsymaqk
ygidmidekkqsiaysrdqvrelfgfykklvdshvipdqryfssfgrtnvyeirpwinge
lagmylwdsaiytyssnmpkdavletgpfitipgakdsgltskpsslfaisknskhpkea
amlmnfmlsnpegvkalglqngmpanpkaqklledigvinpgnllanayraaaaqpeskv
avspfmenqelvqlwttslqkldygngevnkvaddflsganrilkrair

Timeline for d4ry1b1:

• d4ry1b1 first appeared in SCOPe 2.05, called d4ry1b_
  
• d4ry1b1 appears in SCOPe 2.06
  
• d4ry1b1 appears in the current release, SCOPe 2.08