Lineage for d4ry1b_ (4ry1 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880805Species Pectobacterium atrosepticum [TaxId:218491] [268814] (1 PDB entry)
  8. 1880807Domain d4ry1b_: 4ry1 B: [268816]
    automated match to d2uvga_
    complexed with act, gol

Details for d4ry1b_

PDB Entry: 4ry1 (more details), 1.4 Å

PDB Description: crystal structure of periplasmic solute binding protein eca2210 from pectobacterium atrosepticum scri1043, target efi-510858
PDB Compounds: (B:) Periplasmic solute binding protein

SCOPe Domain Sequences for d4ry1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ry1b_ c.94.1.0 (B:) automated matches {Pectobacterium atrosepticum [TaxId: 218491]}
maeiriswwggnqrheatlaainafqkanptitvkaeyagwdgylsrlstqiaggqepdv
mridwnwlpqfsrngdgfydlnkqkdilglgdfppnalktadvkgklqglpismtsrsmi
ynkttwdnagvaypktwdelfaagpvfkqklgdsyyplgvaqgasdvldiltlgrsymaq
kygidmidekkqsiaysrdqvrelfgfykklvdshvipdqryfssfgrtnvyeirpwing
elagmylwdsaiytyssnmpkdavletgpfitipgakdsgltskpsslfaisknskhpke
aamlmnfmlsnpegvkalglqngmpanpkaqklledigvinpgnllanayraaaaqpesk
vavspfmenqelvqlwttslqkldygngevnkvaddflsganrilkrair

SCOPe Domain Coordinates for d4ry1b_:

Click to download the PDB-style file with coordinates for d4ry1b_.
(The format of our PDB-style files is described here.)

Timeline for d4ry1b_: