Lineage for d4rwea_ (4rwe A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1878507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1878777Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 1878778Protein automated matches [190646] (60 species)
    not a true protein
  7. 1879040Species Yersinia pestis [TaxId:1035377] [268812] (1 PDB entry)
  8. 1879041Domain d4rwea_: 4rwe A: [268813]
    automated match to d2fn8a_
    complexed with cl, gol

Details for d4rwea_

PDB Entry: 4rwe (more details), 1.65 Å

PDB Description: the crystal structure of a sugar-binding transport protein from yersinia pestis co92
PDB Compounds: (A:) Sugar-binding transport protein

SCOPe Domain Sequences for d4rwea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rwea_ c.93.1.0 (A:) automated matches {Yersinia pestis [TaxId: 1035377]}
elnsigvtvgdlanpffvqitkgvelearklagdkvkvtlvssgydlgqqvaqidnfiaa
kvdmiilnaadskgigpavkrakdagivvvavdvaaegadatitsdntqagamackyisd
rlkekgnvviingppvsaiqnrvegcesefkkypdikvlssnqnakgsregglevmtsll
avnpkidgvfaindptaigadlaakqaqrneffivgvdgspdaeealkrggntlfvatpa
qdpqvmaskavevgygilqgnpapkdpilipvtlidknnistykgwt

SCOPe Domain Coordinates for d4rwea_:

Click to download the PDB-style file with coordinates for d4rwea_.
(The format of our PDB-style files is described here.)

Timeline for d4rwea_: