| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
| Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
| Protein automated matches [190646] (60 species) not a true protein |
| Species Yersinia pestis [TaxId:1035377] [268812] (1 PDB entry) |
| Domain d4rwea_: 4rwe A: [268813] automated match to d2fn8a_ complexed with cl, gol |
PDB Entry: 4rwe (more details), 1.65 Å
SCOPe Domain Sequences for d4rwea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rwea_ c.93.1.0 (A:) automated matches {Yersinia pestis [TaxId: 1035377]}
elnsigvtvgdlanpffvqitkgvelearklagdkvkvtlvssgydlgqqvaqidnfiaa
kvdmiilnaadskgigpavkrakdagivvvavdvaaegadatitsdntqagamackyisd
rlkekgnvviingppvsaiqnrvegcesefkkypdikvlssnqnakgsregglevmtsll
avnpkidgvfaindptaigadlaakqaqrneffivgvdgspdaeealkrggntlfvatpa
qdpqvmaskavevgygilqgnpapkdpilipvtlidknnistykgwt
Timeline for d4rwea_: