![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
![]() | Protein automated matches [190646] (77 species) not a true protein |
![]() | Species Mannheimia haemolytica [TaxId:272629] [268809] (1 PDB entry) |
![]() | Domain d4rxma1: 4rxm A:23-311 [268810] Other proteins in same PDB: d4rxma2 automated match to d2ioya_ complexed with asp, bgc, cl, ins |
PDB Entry: 4rxm (more details), 1.75 Å
SCOPe Domain Sequences for d4rxma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rxma1 c.93.1.0 (A:23-311) automated matches {Mannheimia haemolytica [TaxId: 272629]} kdelvvfslpnlsspfevqlqkvavetskkleiklqvldgqssstkqasdlenaitrgak giiispndvnaisgaveeiikekipaatldrkvesskpvphfgannytggqevakavkak ypngakiilltgqpgstsniertkgirdelaaggdkykivvdqtgnwlrseglriiesvl ptlkekpeviisanddmalgaiealrsqglkagdilvtgfdstpealarvkdgwlyltad qrpsfavstaleqvvgnireskevsgadyppkiilkdnlqeaerfaeis
Timeline for d4rxma1: