Lineage for d1pfza_ (1pfz A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15989Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 16118Protein Plasmepsin ii (a hemoglobin-degrading enzyme) [50673] (2 species)
  7. 16119Species Plasmodium falciparum [50674] (2 PDB entries)
  8. 16120Domain d1pfza_: 1pfz A: [26881]

Details for d1pfza_

PDB Entry: 1pfz (more details), 1.85 Å

PDB Description: proplasmepsin ii from plasmodium falciparum

SCOP Domain Sequences for d1pfza_:

Sequence, based on SEQRES records: (download)

>d1pfza_ b.50.1.2 (A:) Plasmepsin ii (a hemoglobin-degrading enzyme) {Plasmodium falciparum}
hltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielvdfqni
mfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekdgtkve
mnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwkdlsig
svdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnhdlywq
itldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlcnnskl
ptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrkyftvfd
ydnhsvgialakknl

Sequence, based on observed residues (ATOM records): (download)

>d1pfza_ b.50.1.2 (A:) Plasmepsin ii (a hemoglobin-degrading enzyme) {Plasmodium falciparum}
hltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielvdfqni
mfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekdgtkve
mtvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwkdlsigsvdpi
vvelknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnhdlywqitlda
hvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlcnnsklptfef
tsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrkyftvfdydnhs
vgialakknl

SCOP Domain Coordinates for d1pfza_:

Click to download the PDB-style file with coordinates for d1pfza_.
(The format of our PDB-style files is described here.)

Timeline for d1pfza_: