Lineage for d4rxta1 (4rxt A:33-325)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913241Species Agrobacterium radiobacter [TaxId:311403] [268807] (1 PDB entry)
  8. 2913242Domain d4rxta1: 4rxt A:33-325 [268808]
    Other proteins in same PDB: d4rxta2
    automated match to d4wuta_
    complexed with ara

Details for d4rxta1

PDB Entry: 4rxt (more details), 1.35 Å

PDB Description: crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
PDB Compounds: (A:) Sugar ABC transporter

SCOPe Domain Sequences for d4rxta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rxta1 c.93.1.0 (A:33-325) automated matches {Agrobacterium radiobacter [TaxId: 311403]}
aevtipiivkdttsfywqivlagarkagkdlgvkvpelgaqaetdvngqisilenavagk
paaivisptefkalgkpvdeaaksvpiigidsgadskafksflttdntqggriaadglaa
aikamtgkeegdvviitntpgagsleqrrtgfldqvktkypglkvvadkyadgqattgln
imtdlitanpkivgvfasnlimaqgvgqaiaenklsdkvkvigfdsddktlgflksgaia
glvvqdpyrmgydgiktalavskgekveanvdtganlvtkanmsdpkiealin

SCOPe Domain Coordinates for d4rxta1:

Click to download the PDB-style file with coordinates for d4rxta1.
(The format of our PDB-style files is described here.)

Timeline for d4rxta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rxta2