Lineage for d4rxla_ (4rxl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916390Species Vibrio cholerae [TaxId:243277] [268805] (4 PDB entries)
  8. 2916391Domain d4rxla_: 4rxl A: [268806]
    automated match to d4kd5d_
    complexed with wo4

Details for d4rxla_

PDB Entry: 4rxl (more details), 1.52 Å

PDB Description: crystal structure of molybdenum abc transporter solute binding protein vc_a0726 from vibrio cholerae, target efi-510913, in complex with tungstate
PDB Compounds: (A:) Molybdenum ABC transporter, periplasmic molybdenum-binding protein

SCOPe Domain Sequences for d4rxla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rxla_ c.94.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
tlhiyaassmtnavnalvadysqqhdvklvtvyggssslarqieagapadlfisaneewa
nylvekglvkpnkvvtlaanslvlirptaqpvasfelqdaaawqtaladsrlavaqvdav
pagmyakqalqhagvwpelesrlaqtnnvrlalalvergesplgivyktdallsdkvtiv
tafsaqshqpiryplaqlndkaasaewvaylrsdaaqqilqrfgfesvs

SCOPe Domain Coordinates for d4rxla_:

Click to download the PDB-style file with coordinates for d4rxla_.
(The format of our PDB-style files is described here.)

Timeline for d4rxla_: