| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) ![]() |
| Family c.23.10.0: automated matches [191588] (1 protein) not a true family |
| Protein automated matches [191059] (16 species) not a true protein |
| Species Veillonella parvula [TaxId:479436] [268802] (1 PDB entry) |
| Domain d4rw0b1: 4rw0 B:1-182 [268804] Other proteins in same PDB: d4rw0a2, d4rw0b2 automated match to d4rsha_ complexed with gol, na |
PDB Entry: 4rw0 (more details), 2 Å
SCOPe Domain Sequences for d4rw0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rw0b1 c.23.10.0 (B:1-182) automated matches {Veillonella parvula [TaxId: 479436]}
meiicfgdsitrgydvpygrgwveicdasienvnftnygedgcsvqgmiynienwavtav
sdptrhiflmcgtndilqgrdstyvyktlvkaielastkgmviigletqidsdmdgldlv
vrevneqlkayaaehnikvidfyttlfeadqigqivfagevhpnergyrlmaykalevft
rl
Timeline for d4rw0b1: