Lineage for d4rw0a1 (4rw0 A:1-182)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857506Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 2857507Protein automated matches [191059] (16 species)
    not a true protein
  7. 2857581Species Veillonella parvula [TaxId:479436] [268802] (1 PDB entry)
  8. 2857582Domain d4rw0a1: 4rw0 A:1-182 [268803]
    Other proteins in same PDB: d4rw0a2, d4rw0b2
    automated match to d4rsha_
    complexed with gol, na

Details for d4rw0a1

PDB Entry: 4rw0 (more details), 2 Å

PDB Description: Crystal structure of a member of the lipolytic protein G-D-S-L family from Veillonella parvula DSM 2008
PDB Compounds: (A:) Lipolytic protein G-D-S-L family

SCOPe Domain Sequences for d4rw0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rw0a1 c.23.10.0 (A:1-182) automated matches {Veillonella parvula [TaxId: 479436]}
meiicfgdsitrgydvpygrgwveicdasienvnftnygedgcsvqgmiynienwavtav
sdptrhiflmcgtndilqgrdstyvyktlvkaielastkgmviigletqidsdmdgldlv
vrevneqlkayaaehnikvidfyttlfeadqigqivfagevhpnergyrlmaykalevft
rl

SCOPe Domain Coordinates for d4rw0a1:

Click to download the PDB-style file with coordinates for d4rw0a1.
(The format of our PDB-style files is described here.)

Timeline for d4rw0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rw0a2