SCOPe 2.08: Domain d4rw0a1: 4rw0 A:1-182

Lineage for d4rw0a1 (4rw0 A:1-182)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.0: automated matches [191588] (1 protein)
   not a true family

6. Protein automated matches [191059] (16 species)
   not a true protein

7. Species Veillonella parvula [TaxId:479436] [268802] (1 PDB entry)

8. Domain d4rw0a1: 4rw0 A:1-182 [268803]
   Other proteins in same PDB: d4rw0a2, d4rw0b2
   automated match to d4rsha_
   complexed with gol, na

Details for d4rw0a1

PDB Entry: 4rw0, 2 Å

PDB Description: Crystal structure of a member of the lipolytic protein G-D-S-L family from Veillonella parvula DSM 2008

PDB Compounds: (A:) Lipolytic protein G-D-S-L family

SCOPe Domain Sequences for d4rw0a1:

Sequence; same for both SEQRES and ATOM records:

>d4rw0a1 c.23.10.0 (A:1-182) automated matches {Veillonella parvula [TaxId: 479436]}
meiicfgdsitrgydvpygrgwveicdasienvnftnygedgcsvqgmiynienwavtav
sdptrhiflmcgtndilqgrdstyvyktlvkaielastkgmviigletqidsdmdgldlv
vrevneqlkayaaehnikvidfyttlfeadqigqivfagevhpnergyrlmaykalevft
rl

Timeline for d4rw0a1:

• d4rw0a1 first appeared in SCOPe 2.05, called d4rw0a_
  
• d4rw0a1 appears in SCOPe 2.07