Lineage for d4ruid_ (4rui D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743740Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1743741Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1744326Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1744327Protein automated matches [190847] (45 species)
    not a true protein
  7. 1744362Species Human (Homo sapiens) [TaxId:9606] [196470] (29 PDB entries)
  8. 1744456Domain d4ruid_: 4rui D: [268801]
    automated match to d1dt6a_
    complexed with hem, sne

Details for d4ruid_

PDB Entry: 4rui (more details), 2.61 Å

PDB Description: crystal structure of a cytochrome p450 2a6 in complex with a monoterpene - sabinene.
PDB Compounds: (D:) Cytochrome P450 2A6

SCOPe Domain Sequences for d4ruid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ruid_ a.104.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavrea
lvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriq
eeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgifq
ftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfids
flirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvhee
idrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgte
vypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelf
lffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflprh

SCOPe Domain Coordinates for d4ruid_:

Click to download the PDB-style file with coordinates for d4ruid_.
(The format of our PDB-style files is described here.)

Timeline for d4ruid_:

  • d4ruid_ appears in periodic updates to SCOPe 2.05 starting on 2015-02-20
  • d4ruid_ is called d4ruid1 in SCOPe 2.06
  • d4ruid_ appears in the current release, SCOPe 2.07, called d4ruid1