Lineage for d1fknb_ (1fkn B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671907Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 671908Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 672460Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 672515Protein beta-secretase (memapsin) [50671] (1 species)
  7. 672516Species Human (Homo sapiens) [TaxId:9606] [50672] (30 PDB entries)
  8. 672519Domain d1fknb_: 1fkn B: [26880]
    complexed with alq, lol

Details for d1fknb_

PDB Entry: 1fkn (more details), 1.9 Å

PDB Description: Structure of Beta-Secretase Complexed with Inhibitor
PDB Compounds: (B:) memapsin 2

SCOP Domain Sequences for d1fknb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fknb_ b.50.1.2 (B:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

SCOP Domain Coordinates for d1fknb_:

Click to download the PDB-style file with coordinates for d1fknb_.
(The format of our PDB-style files is described here.)

Timeline for d1fknb_: