Lineage for d1fknb_ (1fkn B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15989Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 16027Protein beta-secretase (memapsin) [50671] (1 species)
  7. 16028Species Human (Homo sapiens) [TaxId:9606] [50672] (1 PDB entry)
  8. 16030Domain d1fknb_: 1fkn B: [26880]

Details for d1fknb_

PDB Entry: 1fkn (more details), 1.9 Å

PDB Description: Structure of Beta-Secretase Complexed with Inhibitor
PDB Compounds: (B:)

SCOP Domain Sequences for d1fknb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fknb_ b.50.1.2 (B:) beta-secretase (memapsin) {Human (Homo sapiens)}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

SCOP Domain Coordinates for d1fknb_:

Click to download the PDB-style file with coordinates for d1fknb_.
(The format of our PDB-style files is described here.)

Timeline for d1fknb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fkna_