Lineage for d4rv8d_ (4rv8 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080779Species Cryptosporidium parvum [TaxId:5807] [234914] (4 PDB entries)
  8. 2080787Domain d4rv8d_: 4rv8 D: [268794]
    Other proteins in same PDB: d4rv8c2
    automated match to d4myxb_
    complexed with gol, i13, imp, peg

Details for d4rv8d_

PDB Entry: 4rv8 (more details), 2.05 Å

PDB Description: co-crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from cryptosporidium parvum and the inhibitor p131
PDB Compounds: (D:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d4rv8d_:

Sequence, based on SEQRES records: (download)

>d4rv8d_ c.1.5.0 (D:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
mgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmav
gmarlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdvivl
dsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsicttr
ivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsilagte
espgekeligdtvykyyrgmgsvgamksgsgdryfqekrpenkmvpegiegrvkykgeme
gvvyqlvgglrscmgylgsasieelwkkssyveittsglreshvhdveiv

Sequence, based on observed residues (ATOM records): (download)

>d4rv8d_ c.1.5.0 (D:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
mgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmav
gmarlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdvivl
dsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsicttr
ivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsilagte
espgekeligdtvykyyrgmgsvgamkskmvpegiegrvkykgemegvvyqlvgglrscm
gylgsasieelwkkssyveittdveiv

SCOPe Domain Coordinates for d4rv8d_:

Click to download the PDB-style file with coordinates for d4rv8d_.
(The format of our PDB-style files is described here.)

Timeline for d4rv8d_: