Lineage for d4ruif1 (4rui F:31-494)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005688Domain d4ruif1: 4rui F:31-494 [268791]
    Other proteins in same PDB: d4ruib2, d4ruid2, d4ruie2, d4ruif2
    automated match to d1dt6a_
    complexed with hem, sne

Details for d4ruif1

PDB Entry: 4rui (more details), 2.61 Å

PDB Description: crystal structure of a cytochrome p450 2a6 in complex with a monoterpene - sabinene.
PDB Compounds: (F:) Cytochrome P450 2A6

SCOPe Domain Sequences for d4ruif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ruif1 a.104.1.0 (F:31-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavrea
lvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriq
eeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgifq
ftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfids
flirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvhee
idrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgte
vypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelf
lffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflpr

SCOPe Domain Coordinates for d4ruif1:

Click to download the PDB-style file with coordinates for d4ruif1.
(The format of our PDB-style files is described here.)

Timeline for d4ruif1:

  • d4ruif1 first appeared in SCOPe 2.05, called d4ruif_