| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
| Domain d4rgne1: 4rgn E:1-113 [268784] Other proteins in same PDB: d4rgna1, d4rgna2, d4rgnc1, d4rgnc2, d4rgnd2, d4rgne2, d4rgnf2, d4rgng2, d4rgnl1, d4rgnl2, d4rgns1, d4rgns2 automated match to d1a5fl1 |
PDB Entry: 4rgn (more details), 2.7 Å
SCOPe Domain Sequences for d4rgne1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rgne1 b.1.1.1 (E:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspssltvtagekvtmtckssqslfnsgnqknfltwyqqipgqppklliywastr
dsgvpdrftgsgsgtdftltissvqaedlavyycqndytypltfgvgtklelk
Timeline for d4rgne1: