Lineage for d4rrta_ (4rrt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005449Species Human (Homo sapiens) [TaxId:9606] [189507] (40 PDB entries)
  8. 2005465Domain d4rrta_: 4rrt A: [268783]
    automated match to d3g5nc_
    complexed with 3v4, cm5, gol, hem

Details for d4rrta_

PDB Entry: 4rrt (more details), 2.2 Å

PDB Description: crystal structure of a human cytochrome p450 2b6 (y226h/k262r) in complex with (+)-3-carene
PDB Compounds: (A:) Cytochrome P450 2B6

SCOPe Domain Sequences for d4rrta_:

Sequence, based on SEQRES records: (download)

>d4rrta_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea
lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgkrsveeriq
eeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfs
lissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidt
yllhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyre
ieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdte
vflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelf
lffttilqnfsmaspvapedidltpqecgvgkipptyqirflpr

Sequence, based on observed residues (ATOM records): (download)

>d4rrta_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea
lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfkrsveeriqeea
qclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfslis
svfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidtyll
hmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyreieq
vigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdtevfl
ilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelflff
ttilqnfsmaspvapedidltpqecgvgkipptyqirflpr

SCOPe Domain Coordinates for d4rrta_:

Click to download the PDB-style file with coordinates for d4rrta_.
(The format of our PDB-style files is described here.)

Timeline for d4rrta_: