Lineage for d1smra_ (1smr A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15989Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 16041Protein Chymosin (synonim: renin) [50667] (3 species)
  7. 16057Species Mouse (Mus musculus) [TaxId:10090] [50670] (1 PDB entry)
  8. 16058Domain d1smra_: 1smr A: [26878]

Details for d1smra_

PDB Entry: 1smr (more details), 2 Å

PDB Description: the 3-d structure of mouse submaxillary renin complexed with a decapeptide inhibitor ch-66 based on the 4-16 fragment of rat angiotensinogen

SCOP Domain Sequences for d1smra_:

Sequence, based on SEQRES records: (download)

>d1smra_ b.50.1.2 (A:) Chymosin (synonim: renin) {Mouse (Mus musculus)}
tdlispvvltnylnsqyygeigigtppqtfkvifdtgsanlwvpstkcsrlylacgihsl
yessdsssymengddftihygsgrvkgflsqdsvtvggitvtqtfgevtqlplipfmlaq
fdgvlgmgfpaqavggvtpvfdhilsqgvlkekvfsvyynrgphllggevvlggsdpqhy
qgdfhyvslsktdswqitmkgvsvgsstllceegcevvvdtgssfisaptsslklimqal
gakekrlheyvvscsqvptlpdisfnlggraytlsstdyvlqypnrrdklctvalhamdi
ppptgpvwvlgatfirkfytefdrhnnrigfalar

Sequence, based on observed residues (ATOM records): (download)

>d1smra_ b.50.1.2 (A:) Chymosin (synonim: renin) {Mouse (Mus musculus)}
tdlispvvltnylnsqyygeigigtppqtfkvifdtgsanlwvpstkcsrlylacgihsl
yessdsssymengddftihygsgrvkgflsqdsvtvggitvtqtfgevtqlplipfmlaq
fdgvlgmgfpaqavggvtpvfdhilsqgvlkekvfsvyynrgphllggevvlggsdpqhy
qgdfhyvslsktdswqitmkgvsvgsstllceegcevvvdtgssfisaptsslklimqal
gakekrlheyvvscsqvptlpdisfnlggraytlsstdyvlqrdklctvalhamdipppt
gpvwvlgatfirkfytefdrhnnrigfalar

SCOP Domain Coordinates for d1smra_:

Click to download the PDB-style file with coordinates for d1smra_.
(The format of our PDB-style files is described here.)

Timeline for d1smra_: