| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d4rgnc1: 4rgn C:1-107 [268773] Other proteins in same PDB: d4rgna1, d4rgna2, d4rgnb_, d4rgnc2, d4rgnd1, d4rgnd2, d4rgne1, d4rgne2, d4rgnf1, d4rgnf2, d4rgng1, d4rgng2, d4rgnh_, d4rgnl2, d4rgns1, d4rgns2 automated match to d1h3pl1 |
PDB Entry: 4rgn (more details), 2.7 Å
SCOPe Domain Sequences for d4rgnc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rgnc1 b.1.1.0 (C:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspatlsvtpgdrvslscrasqsigdylhwyqqkshesprllinyasqsisgips
rfsgsgsgsdftliinsvepedvgvyycqnghsfpytfgggtkleir
Timeline for d4rgnc1: