Lineage for d4rgnc1 (4rgn C:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761066Domain d4rgnc1: 4rgn C:1-107 [268773]
    Other proteins in same PDB: d4rgna1, d4rgna2, d4rgnb_, d4rgnc2, d4rgnd1, d4rgnd2, d4rgne1, d4rgne2, d4rgnf1, d4rgnf2, d4rgng1, d4rgng2, d4rgnh_, d4rgnl2, d4rgns1, d4rgns2
    automated match to d1h3pl1

Details for d4rgnc1

PDB Entry: 4rgn (more details), 2.7 Å

PDB Description: structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
PDB Compounds: (C:) 14G8 light chain

SCOPe Domain Sequences for d4rgnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rgnc1 b.1.1.0 (C:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspatlsvtpgdrvslscrasqsigdylhwyqqkshesprllinyasqsisgips
rfsgsgsgsdftliinsvepedvgvyycqnghsfpytfgggtkleir

SCOPe Domain Coordinates for d4rgnc1:

Click to download the PDB-style file with coordinates for d4rgnc1.
(The format of our PDB-style files is described here.)

Timeline for d4rgnc1: