Lineage for d4rqla1 (4rql A:28-491)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005449Species Human (Homo sapiens) [TaxId:9606] [189507] (40 PDB entries)
  8. 2005462Domain d4rqla1: 4rql A:28-491 [268770]
    Other proteins in same PDB: d4rqla2, d4rqlb2
    automated match to d3g5nc_
    complexed with cm5, edo, hem, sne

Details for d4rqla1

PDB Entry: 4rql (more details), 2.1 Å

PDB Description: crystal structure of a human cytochrome p450 2b6 (y226h/k262r) in complex with a monoterpene - sabinene
PDB Compounds: (A:) Cytochrome P450 2B6

SCOPe Domain Sequences for d4rqla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rqla1 a.104.1.1 (A:28-491) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea
lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgkrsveeriq
eeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfs
lissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidt
yllhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyre
ieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdte
vflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelf
lffttilqnfsmaspvapedidltpqecgvgkipptyqirflpr

SCOPe Domain Coordinates for d4rqla1:

Click to download the PDB-style file with coordinates for d4rqla1.
(The format of our PDB-style files is described here.)

Timeline for d4rqla1:

  • d4rqla1 first appeared in SCOPe 2.05, called d4rqla_

View in 3D
Domains from same chain:
(mouse over for more information)
d4rqla2