SCOPe 2.05: Domain d4rpid_: 4rpi D:

Lineage for d4rpid_ (4rpi D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (41 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [226769] (4 PDB entries)

8. Domain d4rpid_: 4rpi D: [268768]
   automated match to d1yula_
   complexed with dms, epe

Details for d4rpid_

PDB Entry: 4rpi, 2.42 Å

PDB Description: crystal structure of nicotinate mononucleotide adenylyltransferase from mycobacterium tuberculosis

PDB Compounds: (D:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d4rpid_:

Sequence, based on SEQRES records:

>d4rpid_ c.26.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtvi
atasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimsaqgweel
felarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwy
lmpdgvvqyvskcrlycg

Sequence, based on observed residues (ATOM records):

>d4rpid_ c.26.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpgrqvsaaehrylmtviata
snprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimsaqgweelfel
arfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwylmp
dgvvqyvskcrlycg

Timeline for d4rpid_:

• d4rpid_ is new in SCOPe 2.05-stable
  
• d4rpid_ is called d4rpid1 in SCOPe 2.06
  
• d4rpid_ appears in the current release, SCOPe 2.08, called d4rpid1