Lineage for d4rpia1 (4rpi A:9-201)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2861021Species Mycobacterium tuberculosis [TaxId:1773] [226769] (5 PDB entries)
  8. 2861035Domain d4rpia1: 4rpi A:9-201 [268766]
    Other proteins in same PDB: d4rpia2, d4rpib2, d4rpic2, d4rpid2
    automated match to d1yula_
    complexed with dms, epe

Details for d4rpia1

PDB Entry: 4rpi (more details), 2.42 Å

PDB Description: crystal structure of nicotinate mononucleotide adenylyltransferase from mycobacterium tuberculosis
PDB Compounds: (A:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d4rpia1:

Sequence, based on SEQRES records: (download)

>d4rpia1 c.26.1.0 (A:9-201) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtviatasn
prfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimsaqgweelfelar
fvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwylmpdg
vvqyvskcrlycg

Sequence, based on observed residues (ATOM records): (download)

>d4rpia1 c.26.1.0 (A:9-201) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mggtfdpihyghlvaasevadlfdldevvfvpsgqgrqvsaaehrylmtviatasnprfs
vsrvdidrggptytkdtladlhalhpdselyfttgadalasimsaqgweelfelarfvgv
srpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwylmpdgvvqy
vskcrlycg

SCOPe Domain Coordinates for d4rpia1:

Click to download the PDB-style file with coordinates for d4rpia1.
(The format of our PDB-style files is described here.)

Timeline for d4rpia1: