![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.107: DHH phosphoesterases [64181] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 6 strands, order 321456 Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest |
![]() | Superfamily c.107.1: DHH phosphoesterases [64182] (3 families) ![]() constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains |
![]() | Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (2 proteins) |
![]() | Protein automated matches [190947] (2 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [268759] (1 PDB entry) |
![]() | Domain d4rpab_: 4rpa B: [268765] automated match to d2iw4b_ complexed with mn |
PDB Entry: 4rpa (more details), 2.1 Å
SCOPe Domain Sequences for d4rpab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rpab_ c.107.1.1 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} aktyifghknpdtdaissaiimaefeqlrgnsgakayrlgdvsaetqfaldtfnvpapel ltddldgqdvilvdhnefqqssdtiasatikhvidhhrianfetagplcyraepvgctat ilykmfrergfeikpeiaglmlsaiisdsllfksptctqqdvkaaeelkdiakvdiqkyg ldmlkagasttdksvefllnmdaksftmgdyvtriaqvnavdldevlnrkedlekemlav saqekydlfvlvvtdiinsdskilvvgaekdkvgeafnvqleddmaflsgvvsrkkqivp qitealtk
Timeline for d4rpab_: