Lineage for d4rpaa_ (4rpa A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919431Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 6 strands, order 321456
    Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest
  4. 2919432Superfamily c.107.1: DHH phosphoesterases [64182] (3 families) (S)
    constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains
  5. 2919433Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (2 proteins)
  6. 2919456Protein automated matches [190947] (2 species)
    not a true protein
  7. 2919457Species Staphylococcus aureus [TaxId:1280] [268759] (1 PDB entry)
  8. 2919458Domain d4rpaa_: 4rpa A: [268760]
    automated match to d2iw4b_
    complexed with mn

Details for d4rpaa_

PDB Entry: 4rpa (more details), 2.1 Å

PDB Description: crystal structure of inorganic pyrophosphatase from staphylococcus aureus in complex with mn2+
PDB Compounds: (A:) probable manganese-dependent inorganic pyrophosphatase

SCOPe Domain Sequences for d4rpaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rpaa_ c.107.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
aktyifghknpdtdaissaiimaefeqlrgnsgakayrlgdvsaetqfaldtfnvpapel
ltddldgqdvilvdhnefqqssdtiasatikhvidhhrianfetagplcyraepvgctat
ilykmfrergfeikpeiaglmlsaiisdsllfksptctqqdvkaaeelkdiakvdiqkyg
ldmlkagasttdksvefllnmdaksftmgdyvtriaqvnavdldevlnrkedlekemlav
saqekydlfvlvvtdiinsdskilvvgaekdkvgeafnvqleddmaflsgvvsrkkqivp
qitealtk

SCOPe Domain Coordinates for d4rpaa_:

Click to download the PDB-style file with coordinates for d4rpaa_.
(The format of our PDB-style files is described here.)

Timeline for d4rpaa_: