SCOPe 2.05: Domain d4rm7a2: 4rm7 A:230-384

Lineage for d4rm7a2 (4rm7 A:230-384)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (21 species)
   not a true protein

7. Species Slackia heliotrinireducens [TaxId:471855] [268756] (1 PDB entry)

8. Domain d4rm7a2: 4rm7 A:230-384 [268757]
   Other proteins in same PDB: d4rm7a1
   automated match to d2vigd2

Details for d4rm7a2

PDB Entry: 4rm7, 2.53 Å

PDB Description: the crystal structure of acyl-coa dehydrogenase from slackia heliotrinireducens dsm 20476

PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4rm7a2:

Sequence, based on SEQRES records:

>d4rm7a2 a.29.3.0 (A:230-384) automated matches {Slackia heliotrinireducens [TaxId: 471855]}
kgfsqlyslleygrvftcaaalgeaqaamedavawargreafgqriadlqqvqmklteme
vkltnmrnlvygaareydrgehkrlsvalmkyyvpkaatevasdamqilggrgyiqenrv
ssiwqdcrgyqfadgtdevmvviaaplileqykas

Sequence, based on observed residues (ATOM records):

>d4rm7a2 a.29.3.0 (A:230-384) automated matches {Slackia heliotrinireducens [TaxId: 471855]}
kgfsqlyslleygrvftcaaalgeaqaamedavawargreaqriadlqqvqmkltemevk
ltnmrnlvygaareydrgehkrlsvalmkyyvpkaatevasdamqilggrgyiqenrvss
iwqdcrgyqfadgtdevmvviaaplileqykas

Timeline for d4rm7a2:

• d4rm7a2 is new in SCOPe 2.05-stable
  
• d4rm7a2 appears in SCOPe 2.06
  
• d4rm7a2 appears in the current release, SCOPe 2.08