Lineage for d4rm7a2 (4rm7 A:230-384)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708693Species Slackia heliotrinireducens [TaxId:471855] [268756] (1 PDB entry)
  8. 2708694Domain d4rm7a2: 4rm7 A:230-384 [268757]
    Other proteins in same PDB: d4rm7a1, d4rm7a3
    automated match to d2vigd2

Details for d4rm7a2

PDB Entry: 4rm7 (more details), 2.53 Å

PDB Description: the crystal structure of acyl-coa dehydrogenase from slackia heliotrinireducens dsm 20476
PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4rm7a2:

Sequence, based on SEQRES records: (download)

>d4rm7a2 a.29.3.0 (A:230-384) automated matches {Slackia heliotrinireducens [TaxId: 471855]}
kgfsqlyslleygrvftcaaalgeaqaamedavawargreafgqriadlqqvqmklteme
vkltnmrnlvygaareydrgehkrlsvalmkyyvpkaatevasdamqilggrgyiqenrv
ssiwqdcrgyqfadgtdevmvviaaplileqykas

Sequence, based on observed residues (ATOM records): (download)

>d4rm7a2 a.29.3.0 (A:230-384) automated matches {Slackia heliotrinireducens [TaxId: 471855]}
kgfsqlyslleygrvftcaaalgeaqaamedavawargreaqriadlqqvqmkltemevk
ltnmrnlvygaareydrgehkrlsvalmkyyvpkaatevasdamqilggrgyiqenrvss
iwqdcrgyqfadgtdevmvviaaplileqykas

SCOPe Domain Coordinates for d4rm7a2:

Click to download the PDB-style file with coordinates for d4rm7a2.
(The format of our PDB-style files is described here.)

Timeline for d4rm7a2: