Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (29 species) not a true protein |
Species Slackia heliotrinireducens [TaxId:471855] [268754] (1 PDB entry) |
Domain d4rm7a1: 4rm7 A:1-229 [268755] Other proteins in same PDB: d4rm7a2, d4rm7a3 automated match to d2viga1 |
PDB Entry: 4rm7 (more details), 2.53 Å
SCOPe Domain Sequences for d4rm7a1:
Sequence, based on SEQRES records: (download)
>d4rm7a1 e.6.1.0 (A:1-229) automated matches {Slackia heliotrinireducens [TaxId: 471855]} mydglsrdeqrllnhvreygekyftpasiskwrkdqglpdevvkafvdldfngfgvihrr nhrtydlfaqvlvieelsrisgaclpfqndllqlqileafassaqtspfrteyqdtgrls yalaisepeagsdtrsmrthvtregdtlvmngtkmfvnngeyapallvsaydktgddgep efsfwmvprsaagiyaypeqkigqsmlpfatvrfdnvevkeswrlkgss
>d4rm7a1 e.6.1.0 (A:1-229) automated matches {Slackia heliotrinireducens [TaxId: 471855]} mydglsrdeqrllnhvreygekyftpasiskwrkdqglpdevvkafvdldfngfgvihrr nhrtydlfaqvlvieelsrisgaclpfqndllqlqileafassaqtspfrteyqdtgrls yalaisepemrthvtregdtlvmngtkmfvnngeyapallvsaydktgddpefsfwmvpr saagiyaypeqkigqsmlpfatvrfdnvevkeswrlkgss
Timeline for d4rm7a1: