SCOPe 2.08: Domain d4rm7a1: 4rm7 A:1-229

Lineage for d4rm7a1 (4rm7 A:1-229)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (29 species)
   not a true protein

7. Species Slackia heliotrinireducens [TaxId:471855] [268754] (1 PDB entry)

8. Domain d4rm7a1: 4rm7 A:1-229 [268755]
   Other proteins in same PDB: d4rm7a2, d4rm7a3
   automated match to d2viga1

Details for d4rm7a1

PDB Entry: 4rm7, 2.53 Å

PDB Description: the crystal structure of acyl-coa dehydrogenase from slackia heliotrinireducens dsm 20476

PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4rm7a1:

Sequence, based on SEQRES records:

>d4rm7a1 e.6.1.0 (A:1-229) automated matches {Slackia heliotrinireducens [TaxId: 471855]}
mydglsrdeqrllnhvreygekyftpasiskwrkdqglpdevvkafvdldfngfgvihrr
nhrtydlfaqvlvieelsrisgaclpfqndllqlqileafassaqtspfrteyqdtgrls
yalaisepeagsdtrsmrthvtregdtlvmngtkmfvnngeyapallvsaydktgddgep
efsfwmvprsaagiyaypeqkigqsmlpfatvrfdnvevkeswrlkgss

Sequence, based on observed residues (ATOM records):

>d4rm7a1 e.6.1.0 (A:1-229) automated matches {Slackia heliotrinireducens [TaxId: 471855]}
mydglsrdeqrllnhvreygekyftpasiskwrkdqglpdevvkafvdldfngfgvihrr
nhrtydlfaqvlvieelsrisgaclpfqndllqlqileafassaqtspfrteyqdtgrls
yalaisepemrthvtregdtlvmngtkmfvnngeyapallvsaydktgddpefsfwmvpr
saagiyaypeqkigqsmlpfatvrfdnvevkeswrlkgss

Timeline for d4rm7a1:

• d4rm7a1 first appeared in SCOPe 2.05
  
• d4rm7a1 appears in SCOPe 2.07