Lineage for d4rm7a1 (4rm7 A:1-229)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015629Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 3015630Protein automated matches [226934] (29 species)
    not a true protein
  7. 3015805Species Slackia heliotrinireducens [TaxId:471855] [268754] (1 PDB entry)
  8. 3015806Domain d4rm7a1: 4rm7 A:1-229 [268755]
    Other proteins in same PDB: d4rm7a2, d4rm7a3
    automated match to d2viga1

Details for d4rm7a1

PDB Entry: 4rm7 (more details), 2.53 Å

PDB Description: the crystal structure of acyl-coa dehydrogenase from slackia heliotrinireducens dsm 20476
PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4rm7a1:

Sequence, based on SEQRES records: (download)

>d4rm7a1 e.6.1.0 (A:1-229) automated matches {Slackia heliotrinireducens [TaxId: 471855]}
mydglsrdeqrllnhvreygekyftpasiskwrkdqglpdevvkafvdldfngfgvihrr
nhrtydlfaqvlvieelsrisgaclpfqndllqlqileafassaqtspfrteyqdtgrls
yalaisepeagsdtrsmrthvtregdtlvmngtkmfvnngeyapallvsaydktgddgep
efsfwmvprsaagiyaypeqkigqsmlpfatvrfdnvevkeswrlkgss

Sequence, based on observed residues (ATOM records): (download)

>d4rm7a1 e.6.1.0 (A:1-229) automated matches {Slackia heliotrinireducens [TaxId: 471855]}
mydglsrdeqrllnhvreygekyftpasiskwrkdqglpdevvkafvdldfngfgvihrr
nhrtydlfaqvlvieelsrisgaclpfqndllqlqileafassaqtspfrteyqdtgrls
yalaisepemrthvtregdtlvmngtkmfvnngeyapallvsaydktgddpefsfwmvpr
saagiyaypeqkigqsmlpfatvrfdnvevkeswrlkgss

SCOPe Domain Coordinates for d4rm7a1:

Click to download the PDB-style file with coordinates for d4rm7a1.
(The format of our PDB-style files is described here.)

Timeline for d4rm7a1: