Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d4rgng2: 4rgn G:114-220 [268753] Other proteins in same PDB: d4rgna1, d4rgna2, d4rgnb_, d4rgnc1, d4rgnd1, d4rgnd2, d4rgne1, d4rgnf1, d4rgnf2, d4rgng1, d4rgnh_, d4rgnl1, d4rgns1, d4rgns2 automated match to d1tqbc2 |
PDB Entry: 4rgn (more details), 2.7 Å
SCOPe Domain Sequences for d4rgng2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rgng2 b.1.1.2 (G:114-220) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqdgvldswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d4rgng2: