Lineage for d4rgng2 (4rgn G:114-220)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753211Domain d4rgng2: 4rgn G:114-220 [268753]
    Other proteins in same PDB: d4rgna1, d4rgna2, d4rgnb_, d4rgnc1, d4rgnd1, d4rgnd2, d4rgne1, d4rgnf1, d4rgnf2, d4rgng1, d4rgnh_, d4rgnl1, d4rgns1, d4rgns2
    automated match to d1tqbc2

Details for d4rgng2

PDB Entry: 4rgn (more details), 2.7 Å

PDB Description: structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
PDB Compounds: (G:) 6D3 light chain

SCOPe Domain Sequences for d4rgng2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rgng2 b.1.1.2 (G:114-220) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqdgvldswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d4rgng2:

Click to download the PDB-style file with coordinates for d4rgng2.
(The format of our PDB-style files is described here.)

Timeline for d4rgng2: