SCOPe 2.08: Domain d4rgng1: 4rgn G:1-113

Lineage for d4rgng1 (4rgn G:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d4rgng1: 4rgn G:1-113 [268752]
   Other proteins in same PDB: d4rgna1, d4rgna2, d4rgnc1, d4rgnc2, d4rgnd2, d4rgne2, d4rgnf2, d4rgng2, d4rgnl1, d4rgnl2, d4rgns1, d4rgns2
   automated match to d1a5fl1

Details for d4rgng1

PDB Entry: 4rgn, 2.7 Å

PDB Description: structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3

PDB Compounds: (G:) 6D3 light chain

SCOPe Domain Sequences for d4rgng1:

Sequence; same for both SEQRES and ATOM records:

>d4rgng1 b.1.1.1 (G:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspssltvtagekvtmtckssqslfnsgnqknfltwyqqipgqppklliywastr
dsgvpdrftgsgsgtdftltissvqaedlavyycqndytypltfgvgtklelk

Timeline for d4rgng1:

• d4rgng1 first appeared in SCOPe 2.05
  
• d4rgng1 appears in SCOPe 2.07