![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Populus tremula [TaxId:47664] [268744] (2 PDB entries) |
![]() | Domain d4ri7a2: 4ri7 A:84-215 [268751] Other proteins in same PDB: d4ri7a1, d4ri7b1 automated match to d1aw9a1 complexed with gsh; mutant |
PDB Entry: 4ri7 (more details), 1.8 Å
SCOPe Domain Sequences for d4ri7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ri7a2 a.45.1.0 (A:84-215) automated matches {Populus tremula [TaxId: 47664]} gnkslygtdilskanidqwvetdgqtfgppsgdlvhdllfssvpvdealikknvdklakv ldiyeqklgqtrflagdefsfadlshlpngdylvnstdkgylftsrknvnrwwteisnre swkkvlemrkna
Timeline for d4ri7a2: