SCOPe 2.07: Domain d4ri7a2: 4ri7 A:84-215

Lineage for d4ri7a2 (4ri7 A:84-215)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (65 species)
   not a true protein

7. Species Populus tremula [TaxId:47664] [268744] (2 PDB entries)

8. Domain d4ri7a2: 4ri7 A:84-215 [268751]
   Other proteins in same PDB: d4ri7a1, d4ri7b1
   automated match to d1aw9a1
   complexed with gsh; mutant

Details for d4ri7a2

PDB Entry: 4ri7, 1.8 Å

PDB Description: Crystal structure of poplar glutathione transferase F1 mutant SER 13 CYS

PDB Compounds: (A:) Phi class glutathione transferase GSTF1

SCOPe Domain Sequences for d4ri7a2:

Sequence; same for both SEQRES and ATOM records:

>d4ri7a2 a.45.1.0 (A:84-215) automated matches {Populus tremula [TaxId: 47664]}
gnkslygtdilskanidqwvetdgqtfgppsgdlvhdllfssvpvdealikknvdklakv
ldiyeqklgqtrflagdefsfadlshlpngdylvnstdkgylftsrknvnrwwteisnre
swkkvlemrkna

Timeline for d4ri7a2:

• d4ri7a2 first appeared in SCOPe 2.05
  
• d4ri7a2 appears in SCOPe 2.06