Lineage for d4ri7a1 (4ri7 A:2-83)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880169Species Populus tremula [TaxId:47664] [188794] (10 PDB entries)
  8. 2880178Domain d4ri7a1: 4ri7 A:2-83 [268750]
    Other proteins in same PDB: d4ri7a2, d4ri7b2
    automated match to d1aw9a2
    complexed with gsh; mutant

Details for d4ri7a1

PDB Entry: 4ri7 (more details), 1.8 Å

PDB Description: Crystal structure of poplar glutathione transferase F1 mutant SER 13 CYS
PDB Compounds: (A:) Phi class glutathione transferase GSTF1

SCOPe Domain Sequences for d4ri7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ri7a1 c.47.1.0 (A:2-83) automated matches {Populus tremula [TaxId: 47664]}
atpvtiygpplctavsrvlatliekdvpfhlipidlskgeqkkpeylkiqpfgqvpafkd
esitlfesraicryicdkyadk

SCOPe Domain Coordinates for d4ri7a1:

Click to download the PDB-style file with coordinates for d4ri7a1.
(The format of our PDB-style files is described here.)

Timeline for d4ri7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ri7a2