Lineage for d1bima_ (1bim A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671907Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 671908Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 672460Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 672585Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 672591Species Human (Homo sapiens) [TaxId:9606] [50669] (9 PDB entries)
  8. 672598Domain d1bima_: 1bim A: [26875]

Details for d1bima_

PDB Entry: 1bim (more details), 2.8 Å

PDB Description: crystallographic studies on the binding modes of p2-p3 butanediamide renin inhibitors
PDB Compounds: (A:) renin

SCOP Domain Sequences for d1bima_:

Sequence, based on SEQRES records: (download)

>d1bima_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
dippptgptwalgatfirkfytefdrrnnrigfalar

Sequence, based on observed residues (ATOM records): (download)

>d1bima_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdseslggqivlggsdpqhy
egnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmeal
gakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdip
pptgptwalgatfirkfytefdrrnnrigfalar

SCOP Domain Coordinates for d1bima_:

Click to download the PDB-style file with coordinates for d1bima_.
(The format of our PDB-style files is described here.)

Timeline for d1bima_: