Lineage for d4ri6b2 (4ri6 B:84-215)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714153Species Populus tremula [TaxId:47664] [268744] (2 PDB entries)
  8. 2714155Domain d4ri6b2: 4ri6 B:84-215 [268747]
    Other proteins in same PDB: d4ri6a1, d4ri6b1
    automated match to d1aw9a1
    complexed with gsh, mes

Details for d4ri6b2

PDB Entry: 4ri6 (more details), 1.52 Å

PDB Description: crystal structure of poplar glutathione transferase f1
PDB Compounds: (B:) Phi class glutathione transferase GSTF1

SCOPe Domain Sequences for d4ri6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ri6b2 a.45.1.0 (B:84-215) automated matches {Populus tremula [TaxId: 47664]}
gnkslygtdilskanidqwvetdgqtfgppsgdlvhdllfssvpvdealikknvdklakv
ldiyeqklgqtrflagdefsfadlshlpngdylvnstdkgylftsrknvnrwwteisnre
swkkvlemrkna

SCOPe Domain Coordinates for d4ri6b2:

Click to download the PDB-style file with coordinates for d4ri6b2.
(The format of our PDB-style files is described here.)

Timeline for d4ri6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ri6b1