SCOPe 2.08: Domain d4ri6b2: 4ri6 B:84-215

Lineage for d4ri6b2 (4ri6 B:84-215)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Populus tremula [TaxId:47664] [268744] (2 PDB entries)

8. Domain d4ri6b2: 4ri6 B:84-215 [268747]
   Other proteins in same PDB: d4ri6a1, d4ri6b1
   automated match to d1aw9a1
   complexed with gsh, mes

Details for d4ri6b2

PDB Entry: 4ri6, 1.52 Å

PDB Description: crystal structure of poplar glutathione transferase f1

PDB Compounds: (B:) Phi class glutathione transferase GSTF1

SCOPe Domain Sequences for d4ri6b2:

Sequence; same for both SEQRES and ATOM records:

>d4ri6b2 a.45.1.0 (B:84-215) automated matches {Populus tremula [TaxId: 47664]}
gnkslygtdilskanidqwvetdgqtfgppsgdlvhdllfssvpvdealikknvdklakv
ldiyeqklgqtrflagdefsfadlshlpngdylvnstdkgylftsrknvnrwwteisnre
swkkvlemrkna

Timeline for d4ri6b2:

• d4ri6b2 first appeared in SCOPe 2.05
  
• d4ri6b2 appears in SCOPe 2.07