| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Populus tremula [TaxId:47664] [188794] (10 PDB entries) |
| Domain d4ri6b1: 4ri6 B:2-83 [268746] Other proteins in same PDB: d4ri6a2, d4ri6b2 automated match to d1aw9a2 complexed with gsh, mes |
PDB Entry: 4ri6 (more details), 1.52 Å
SCOPe Domain Sequences for d4ri6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ri6b1 c.47.1.0 (B:2-83) automated matches {Populus tremula [TaxId: 47664]}
atpvtiygpplstavsrvlatliekdvpfhlipidlskgeqkkpeylkiqpfgqvpafkd
esitlfesraicryicdkyadk
Timeline for d4ri6b1: