SCOPe 2.08: Domain d4rgmb1: 4rgm B:1-107

Lineage for d4rgmb1 (4rgm B:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4rgmb1: 4rgm B:1-107 [268741]
   Other proteins in same PDB: d4rgma1, d4rgma2, d4rgmb2, d4rgmc_, d4rgmh_, d4rgml2, d4rgms1, d4rgms2
   automated match to d1h3pl1

Details for d4rgmb1

PDB Entry: 4rgm, 2.69 Å

PDB Description: structure of staphylococcal enterotoxin b bound to the neutralizing antibody 20b1

PDB Compounds: (B:) 20B1 light chain

SCOPe Domain Sequences for d4rgmb1:

Sequence; same for both SEQRES and ATOM records:

>d4rgmb1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsaslgervsltcrasqeisdyltwlqqkpdgtikrliyvassldsgvpk
rfsgsrsgsdysltisslesedfadyyclqyanypwtfgggtkleir

Timeline for d4rgmb1:

• d4rgmb1 first appeared in SCOPe 2.05
  
• d4rgmb1 appears in SCOPe 2.07