![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries) |
![]() | Domain d4rgna2: 4rgn A:122-237 [268732] Other proteins in same PDB: d4rgna1, d4rgnc1, d4rgnc2, d4rgne1, d4rgne2, d4rgng1, d4rgng2, d4rgnl1, d4rgnl2, d4rgns1 automated match to d1se4a2 |
PDB Entry: 4rgn (more details), 2.7 Å
SCOPe Domain Sequences for d4rgna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rgna2 d.15.6.1 (A:122-237) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk
Timeline for d4rgna2: