Lineage for d4rfva_ (4rfv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114530Species Mycobacterium tuberculosis [TaxId:83332] [187746] (21 PDB entries)
  8. 2114531Domain d4rfva_: 4rfv A: [268727]
    automated match to d2ax4b_
    complexed with po4; mutant

Details for d4rfva_

PDB Entry: 4rfv (more details), 1.69 Å

PDB Description: structure of the mycobacterium tuberculosis aps kinase cysc cys556ala mutant
PDB Compounds: (A:) bifunctional enzyme cysn/cysc

SCOPe Domain Sequences for d4rfva_:

Sequence, based on SEQRES records: (download)

>d4rfva_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pprgktvwftglsgsgkssvamlverkllekgisayvldgdnlrhglnadlgfsmadrae
nlrrlshvatlladcghlvlvpaisplaehralarkvhadagidffevfcdtplqdserr
dpkglyakarageithftgidspyqrpknpdlrltpdrsideqaqevidlles

Sequence, based on observed residues (ATOM records): (download)

>d4rfva_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pprgktvwftglsgsgkssvamlverkllekgisayvldgdnlrhglnadlgfsmadrae
nlrrlshvatlladcghlvlvpaisplaehralarkvhadagidffevfcdtpyqrpknp
dlrltpdrsideqaqevidlles

SCOPe Domain Coordinates for d4rfva_:

Click to download the PDB-style file with coordinates for d4rfva_.
(The format of our PDB-style files is described here.)

Timeline for d4rfva_: