Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) |
Family c.87.1.0: automated matches [191559] (1 protein) not a true family |
Protein automated matches [190965] (40 species) not a true protein |
Species Clitoria ternatea [TaxId:43366] [228739] (5 PDB entries) |
Domain d4rela_: 4rel A: [268726] automated match to d3wc4a_ complexed with act, gol, kmp |
PDB Entry: 4rel (more details), 1.75 Å
SCOPe Domain Sequences for d4rela_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rela_ c.87.1.0 (A:) automated matches {Clitoria ternatea [TaxId: 43366]} mknkqhvaifpfpfgshlppllnlvlklahiapntsfsfigthssnaflftkrhipnnir vftisdgipeghvpannpiekldlflstgpdnlrkgielavaetkqsvtciiadafvtss llvaqtlnvpwiafwpnvscslslyfnidlirdkcskdaknatldflpglsklrvedvpq dmldvgeketlfsrtlnslgvvlpqakavvvnffaeldpplfvkymrsklqsllyvvplp cpqlllpeidsngclswldskssrsvayvcfgtvvspppqevvavaealeesgfpfvwal kesllsilpkgfvertstrgkvvswvpqshvlshgsvgvfvthcgansvmesvsngvpmi crpffgdqgiaarviqdiwevgvivegkvftkngfvkslnlilvqedgkkirdnalkvkq ivqdavgphgqaaedfntlvevisss
Timeline for d4rela_: