Lineage for d4rela_ (4rel A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2911058Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2911059Protein automated matches [190965] (40 species)
    not a true protein
  7. 2911103Species Clitoria ternatea [TaxId:43366] [228739] (5 PDB entries)
  8. 2911105Domain d4rela_: 4rel A: [268726]
    automated match to d3wc4a_
    complexed with act, gol, kmp

Details for d4rela_

PDB Entry: 4rel (more details), 1.75 Å

PDB Description: crystal structure of udp-glucose: anthocyanidin 3-o- glucosyltransferase in complex with kaempferol
PDB Compounds: (A:) UDP-glucose:anthocyanidin 3-O-glucosyltransferase

SCOPe Domain Sequences for d4rela_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rela_ c.87.1.0 (A:) automated matches {Clitoria ternatea [TaxId: 43366]}
mknkqhvaifpfpfgshlppllnlvlklahiapntsfsfigthssnaflftkrhipnnir
vftisdgipeghvpannpiekldlflstgpdnlrkgielavaetkqsvtciiadafvtss
llvaqtlnvpwiafwpnvscslslyfnidlirdkcskdaknatldflpglsklrvedvpq
dmldvgeketlfsrtlnslgvvlpqakavvvnffaeldpplfvkymrsklqsllyvvplp
cpqlllpeidsngclswldskssrsvayvcfgtvvspppqevvavaealeesgfpfvwal
kesllsilpkgfvertstrgkvvswvpqshvlshgsvgvfvthcgansvmesvsngvpmi
crpffgdqgiaarviqdiwevgvivegkvftkngfvkslnlilvqedgkkirdnalkvkq
ivqdavgphgqaaedfntlvevisss

SCOPe Domain Coordinates for d4rela_:

Click to download the PDB-style file with coordinates for d4rela_.
(The format of our PDB-style files is described here.)

Timeline for d4rela_: