Lineage for d4re6c2 (4re6 C:322-581)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1870911Family c.69.1.33: Acylamino-acid-releasing enzyme, C-terminal donain [117711] (1 protein)
    closely related to the prolyl peptidase and DPP6 domains ((53496) and 82497)
    automatically mapped to Pfam PF12697
  6. 1870912Protein Acylamino-acid-releasing enzyme, C-terminal donain [117712] (1 species)
  7. 1870913Species Aeropyrum pernix [TaxId:56636] [117713] (10 PDB entries)
    Uniprot Q9YBQ2
  8. 1870934Domain d4re6c2: 4re6 C:322-581 [268721]
    Other proteins in same PDB: d4re6a1, d4re6b1, d4re6c1, d4re6d1
    automated match to d1ve6a2
    complexed with cl, y3a

Details for d4re6c2

PDB Entry: 4re6 (more details), 2.55 Å

PDB Description: acylaminoacyl peptidase complexed with a chloromethylketone inhibitor
PDB Compounds: (C:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d4re6c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4re6c2 c.69.1.33 (C:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}
lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhggpfaedsdswdtf
aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi
mgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimr
srspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintm
edavkillpavfflatqrer

SCOPe Domain Coordinates for d4re6c2:

Click to download the PDB-style file with coordinates for d4re6c2.
(The format of our PDB-style files is described here.)

Timeline for d4re6c2: