SCOPe 2.08: Domain d4re6c2: 4re6 C:322-581

Lineage for d4re6c2 (4re6 C:322-581)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.33: Acylamino-acid-releasing enzyme, C-terminal donain [117711] (1 protein)
   closely related to the prolyl peptidase and DPP6 domains ((53496) and 82497)
   automatically mapped to Pfam PF12697

6. Protein Acylamino-acid-releasing enzyme, C-terminal donain [117712] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [117713] (10 PDB entries)
   Uniprot Q9YBQ2

8. Domain d4re6c2: 4re6 C:322-581 [268721]
   Other proteins in same PDB: d4re6a1, d4re6b1, d4re6c1, d4re6d1
   automated match to d1ve6a2
   complexed with cl, y3a

Details for d4re6c2

PDB Entry: 4re6, 2.55 Å

PDB Description: acylaminoacyl peptidase complexed with a chloromethylketone inhibitor

PDB Compounds: (C:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d4re6c2:

Sequence; same for both SEQRES and ATOM records:

>d4re6c2 c.69.1.33 (C:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}
lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhggpfaedsdswdtf
aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi
mgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimr
srspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintm
edavkillpavfflatqrer

Timeline for d4re6c2:

• d4re6c2 first appeared in SCOPe 2.05
  
• d4re6c2 appears in SCOPe 2.07