Lineage for d1bila_ (1bil A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61252Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 61253Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 61569Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 61627Protein Chymosin (synonim: renin) [50667] (3 species)
  7. 61633Species Human (Homo sapiens) [TaxId:9606] [50669] (6 PDB entries)
  8. 61637Domain d1bila_: 1bil A: [26872]

Details for d1bila_

PDB Entry: 1bil (more details), 2.4 Å

PDB Description: crystallographic studies on the binding modes of p2-p3 butanediamide renin inhibitors

SCOP Domain Sequences for d1bila_:

Sequence, based on SEQRES records: (download)

>d1bila_ b.50.1.2 (A:) Chymosin (synonim: renin) {Human (Homo sapiens)}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
dippptgptwalgatfirkfytefdrrnnrigfalar

Sequence, based on observed residues (ATOM records): (download)

>d1bila_ b.50.1.2 (A:) Chymosin (synonim: renin) {Human (Homo sapiens)}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdseslggqivlggsdpqhy
egnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmeal
gakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdip
pptgptwalgatfirkfytefdrrnnrigfalar

SCOP Domain Coordinates for d1bila_:

Click to download the PDB-style file with coordinates for d1bila_.
(The format of our PDB-style files is described here.)

Timeline for d1bila_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bilb_