![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.33: Acylamino-acid-releasing enzyme, C-terminal donain [117711] (1 protein) closely related to the prolyl peptidase and DPP6 domains ((53496) and 82497) automatically mapped to Pfam PF12697 |
![]() | Protein Acylamino-acid-releasing enzyme, C-terminal donain [117712] (1 species) |
![]() | Species Aeropyrum pernix [TaxId:56636] [117713] (10 PDB entries) Uniprot Q9YBQ2 |
![]() | Domain d4re6b2: 4re6 B:322-580 [268719] Other proteins in same PDB: d4re6a1, d4re6b1, d4re6c1, d4re6d1 automated match to d1ve6a2 complexed with cl, y3a |
PDB Entry: 4re6 (more details), 2.55 Å
SCOPe Domain Sequences for d4re6b2:
Sequence, based on SEQRES records: (download)
>d4re6b2 c.69.1.33 (B:322-580) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhggpfaedsdswdtf aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi mgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimr srspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintm edavkillpavfflatqre
>d4re6b2 c.69.1.33 (B:322-580) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhggpfaedsdswdtf aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi mgysyggymtlcaltmkpglfkagvagasvvdweemyelsaafrnfieqltggsreimrs rspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintme davkillpavfflatqre
Timeline for d4re6b2: