Lineage for d4re5a1 (4re5 A:8-321)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418888Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2418929Family b.69.7.2: Acylamino-acid-releasing enzyme, N-terminal donain [117286] (1 protein)
  6. 2418930Protein Acylamino-acid-releasing enzyme, N-terminal donain [117287] (1 species)
  7. 2418931Species Aeropyrum pernix [TaxId:56636] [117288] (10 PDB entries)
    Uniprot Q9YBQ2
  8. 2418938Domain d4re5a1: 4re5 A:8-321 [268716]
    Other proteins in same PDB: d4re5a2, d4re5b2
    automated match to d1ve6a1
    complexed with act, cl, mpd, y3a

Details for d4re5a1

PDB Entry: 4re5 (more details), 1.9 Å

PDB Description: acylaminoacyl peptidase complexed with a chloromethylketone inhibitor
PDB Compounds: (A:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d4re5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4re5a1 b.69.7.2 (A:8-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}
efsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsv
ldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvft
gatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssggl
rvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrpta
itwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppr
ivslpsgepllegg

SCOPe Domain Coordinates for d4re5a1:

Click to download the PDB-style file with coordinates for d4re5a1.
(The format of our PDB-style files is described here.)

Timeline for d4re5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4re5a2