![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) ![]() |
![]() | Family b.69.7.2: Acylamino-acid-releasing enzyme, N-terminal donain [117286] (1 protein) |
![]() | Protein Acylamino-acid-releasing enzyme, N-terminal donain [117287] (1 species) |
![]() | Species Aeropyrum pernix [TaxId:56636] [117288] (10 PDB entries) Uniprot Q9YBQ2 |
![]() | Domain d4re6d1: 4re6 D:5-321 [268711] Other proteins in same PDB: d4re6a2, d4re6b2, d4re6c2, d4re6d2 automated match to d1ve6a1 complexed with cl, y3a |
PDB Entry: 4re6 (more details), 2.55 Å
SCOPe Domain Sequences for d4re6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4re6d1 b.69.7.2 (D:5-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} mpvefsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepi nsvldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeav vftgatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlss gglrvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyr ptaitwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslst pprivslpsgepllegg
Timeline for d4re6d1: