SCOPe 2.05: Domain d4re6d1: 4re6 D:5-321

Lineage for d4re6d1 (4re6 D:5-321)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families)

5. Family b.69.7.2: Acylamino-acid-releasing enzyme, N-terminal donain [117286] (1 protein)

6. Protein Acylamino-acid-releasing enzyme, N-terminal donain [117287] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [117288] (10 PDB entries)
   Uniprot Q9YBQ2

8. Domain d4re6d1: 4re6 D:5-321 [268711]
   Other proteins in same PDB: d4re6a2, d4re6b2, d4re6c2, d4re6d2
   automated match to d1ve6a1
   complexed with cl, y3a

Details for d4re6d1

PDB Entry: 4re6, 2.55 Å

PDB Description: acylaminoacyl peptidase complexed with a chloromethylketone inhibitor

PDB Compounds: (D:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d4re6d1:

Sequence; same for both SEQRES and ATOM records:

>d4re6d1 b.69.7.2 (D:5-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}
mpvefsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepi
nsvldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeav
vftgatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlss
gglrvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyr
ptaitwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslst
pprivslpsgepllegg

Timeline for d4re6d1:

• d4re6d1 is new in SCOPe 2.05-stable
  
• d4re6d1 appears in SCOPe 2.06
  
• d4re6d1 appears in the current release, SCOPe 2.08