Lineage for d1rnea_ (1rne A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060651Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 2060659Species Human (Homo sapiens) [TaxId:9606] [50669] (76 PDB entries)
  8. 2060698Domain d1rnea_: 1rne A: [26871]
    complexed with c60, nga

Details for d1rnea_

PDB Entry: 1rne (more details), 2.4 Å

PDB Description: the crystal structure of recombinant glycosylated human renin alone and in complex with a transition state analog inhibitor
PDB Compounds: (A:) renin

SCOPe Domain Sequences for d1rnea_:

Sequence, based on SEQRES records: (download)

>d1rnea_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
nttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhklf
dasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlaef
dgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdpq
hyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklme
algakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamd
ippptgptwalgatfirkfytefdrrnnrigfalar

Sequence, based on observed residues (ATOM records): (download)

>d1rnea_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
nttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhklf
dasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlaef
dgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdlggqivlggsdpqhyegnf
hyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmealgakk
rlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdippptg
ptwalgatfirkfytefdrrnnrigfalar

SCOPe Domain Coordinates for d1rnea_:

Click to download the PDB-style file with coordinates for d1rnea_.
(The format of our PDB-style files is described here.)

Timeline for d1rnea_: