Lineage for d4r69a2 (4r69 A:160-331)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1938743Protein Lactate dehydrogenase [56339] (18 species)
  7. 1938797Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (13 PDB entries)
  8. 1938858Domain d4r69a2: 4r69 A:160-331 [268701]
    Other proteins in same PDB: d4r69a1, d4r69b1, d4r69c1, d4r69d1
    automated match to d4l4ra2
    complexed with epe, nai, so4, w13

Details for d4r69a2

PDB Entry: 4r69 (more details), 3.19 Å

PDB Description: Lactate Dehydrogenase in complex with inhibitor compound 13
PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4r69a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r69a2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4r69a2:

Click to download the PDB-style file with coordinates for d4r69a2.
(The format of our PDB-style files is described here.)

Timeline for d4r69a2: