SCOPe 2.08: Domain d4r3vb_: 4r3v B:

Lineage for d4r3vb_ (4r3v B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (20 species)
   not a true protein

7. Species Tannerella forsythia [TaxId:203275] [268687] (1 PDB entry)

8. Domain d4r3vb_: 4r3v B: [268689]
   automated match to d1hv5e_
   complexed with ca, gol, zn

Details for d4r3vb_

PDB Entry: 4r3v, 2.01 Å

PDB Description: structure of karilysin propeptide and catalytic mmp domain

PDB Compounds: (B:) Karilysin

SCOPe Domain Sequences for d4r3vb_:

Sequence; same for both SEQRES and ATOM records:

>d4r3vb_ d.92.1.0 (B:) automated matches {Tannerella forsythia [TaxId: 203275]}
qrlydngpltgdnnyvlqgskwnkttlkyyiynssshlttterenairsafalwsdkstl
sfiqvynpnqadikikwekgnhgdgypfdgntgilahafypppaggnyaghlhfdgdenw
singsgidlitvaahaighllgiehsnvssalmypyytgikrqldnddclavwdlygyp

Timeline for d4r3vb_:

• d4r3vb_ first appeared in SCOPe 2.05
  
• d4r3vb_ appears in SCOPe 2.07